LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114144}},{"elementId":"link_12","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114154}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114644}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114650}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2218300}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2218554}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512251}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516950}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516709}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516120}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514889}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519908}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519900}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519836}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519757}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519254}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519019}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518762}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518483}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518219}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518157}}]); "parameters" : { "initiatorDataMatcher" : "data-lia-message-uid" { "disableLabelLinks" : "false", { element.siblings('li').removeClass('active'); "action" : "rerender" "event" : "addMessageUserEmailSubscription", { "event" : "addMessageUserEmailSubscription", "actions" : [ "actions" : [ Nun habe ich bei Vodafone eine Antenne gekauft und gemerkt, dass die LTE Antenne nur einen Anschluss hat. count = 0; "context" : "", }, ] { "actions" : [ { "entity" : "2218554", var watching = false; ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "initiatorDataMatcher" : "data-lia-kudos-id" HeyIch hab ne frage und zwar ist der Telekom Magneta Hybrid M Tarif zum zocken geeignet? "eventActions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ } }, { { "context" : "envParam:quiltName", ] } }, "action" : "pulsate" { } }, $(document).ready(function(){ } "}); "event" : "expandMessage", "componentId" : "kudos.widget.button", "message" : "2114644", ] }, "}); "actions" : [ "context" : "", }, { { "event" : "AcceptSolutionAction", { "action" : "pulsate" ] LITHIUM.Dialog.options['293991985'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } { { } $(document).ready(function(){ }, } { "actions" : [ ] "context" : "envParam:quiltName", } } "action" : "rerender" ] } } { "action" : "rerender" }); { { "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "componentId" : "kudos.widget.button", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); })(LITHIUM.jQuery); "action" : "rerender" "action" : "rerender" "disableLinks" : "false", }, } "truncateBodyRetainsHtml" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'k8Dusp3hBmS9mQV00gN4UwnfwR3tHDipYN-s_I5SN_I. "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "parameters" : { } "truncateBody" : "true", "useTruncatedSubject" : "true", "truncateBody" : "true", "context" : "envParam:quiltName,product,contextId,contextUrl", "selector" : "#messageview_2", "selector" : "#kudosButtonV2_3", } } "event" : "ProductAnswer", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; ', 'ajax'); LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); ] })(LITHIUM.jQuery); }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); ] "actions" : [ }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73295","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_zbV_zsJwjldFfRNS3fJCouwAzgjkp7t2d8A6OMBxEI. { "useSimpleView" : "false", { if ( neededkeys[count] == key ) { ], "event" : "MessagesWidgetCommentForm", "action" : "rerender" }); "actions" : [ ich habe vor mir ein Vodafone GigaCube zu kaufen. "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] watching = false; { "defaultAriaLabel" : "", "action" : "rerender" "eventActions" : [ }, }, "actions" : [ "action" : "rerender" } }, "actions" : [ Kunden- und Telefonnummer sind hinterlegt. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "MessagesWidgetEditAction", LITHIUM.Loader.runJsAttached(); window.onload = function() { ] "action" : "rerender" { } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2218300,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "componentId" : "kudos.widget.button", "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", "event" : "addThreadUserEmailSubscription", }, "event" : "markAsSpamWithoutRedirect", }); LITHIUM.AjaxSupport.ComponentEvents.set({ { { ] }, "actions" : [ "event" : "MessagesWidgetMessageEdit", ] { "event" : "MessagesWidgetEditCommentForm", } "context" : "", "action" : "rerender" { { "action" : "rerender" } ] } } }, count = 0; "actions" : [ { }, "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "removeMessageUserEmailSubscription", "actions" : [ $(event.data.selector).removeClass('cssmenu-open'); { } "showCountOnly" : "false", ] $(this).toggleClass("view-btn-open view-btn-close"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "context" : "", { "action" : "rerender" Ich denke nicht, dass Dich Vodafone jetzt schon mit einem langsameren Internet "bestraft" - nur weil Du gekündigt hast. { }); }, "actions" : [ "action" : "rerender" "kudosLinksDisabled" : "false", }, "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "QuickReply", "actions" : [ "action" : "rerender" "action" : "rerender" { // console.log('watching: ' + key); { "defaultAriaLabel" : "", } "actions" : [ ] { "event" : "removeMessageUserEmailSubscription", "action" : "pulsate" }, ] "action" : "rerender" // enable redirect to login page when "logmein" is typed into the void =) }, { } "context" : "", ] Bist du sicher, dass du fortfahren möchtest? "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); { "context" : "envParam:feedbackData", "useSimpleView" : "false", "event" : "AcceptSolutionAction", { "event" : "RevokeSolutionAction", }, "actions" : [ 82,99. ', 'ajax'); "action" : "rerender" } "activecastFullscreen" : false, LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { }, }, Sehr positiv waren die ersten Erfahrungen, die Marcus Karle aus Fahrenzhausen bei München mit seinem LTE-Anschluss machte. "useSimpleView" : "false", ] "disableKudosForAnonUser" : "false", "displaySubject" : "true", }); "actions" : [ "action" : "rerender" } ] ] }, }, "event" : "MessagesWidgetCommentForm", "actions" : [ { "context" : "", ] "entity" : "2114154", }, "event" : "ProductAnswer", }, Die Antenne / der Mast, bei dem Du Dich üblicherweise einbuchst (im LTE-Netz) könnte durch mehr Nutzer stärker belastet sein. LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } } "action" : "rerender" LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, { { { "actions" : [ ] $(document).ready(function(){ { "action" : "rerender" { hochauflösende Videos, in Hochgeschwindigkeit und stabil aus dem Netz herunterladen und versenden. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "kudosLinksDisabled" : "false", { "actions" : [ LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_69b82a8d7795d9","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, ] { } }, if ( key == neededkeys[0] ) { { }, "action" : "rerender" ] "parameters" : { { "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" "actions" : [ { "context" : "envParam:feedbackData", "context" : "envParam:feedbackData", { "event" : "ProductAnswerComment", ] "context" : "", "actions" : [ { }, } "messageViewOptions" : "1111110111111111111110111110100101001101" "eventActions" : [ } In den Internetvertrag von meinen Kumpel habe ich eine sehr schnalle Verbindung von 30 Mbit... Bei mir ist 16 MBits DSL + 16 MBits LTE. }); "dialogKey" : "dialogKey" "event" : "MessagesWidgetEditAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); }, }, { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", notifCount = parseInt($(this).html()) + notifCount; "event" : "unapproveMessage", ', 'ajax'); } "context" : "", ] }, "action" : "rerender" Demnach wird es wahrscheinlich daran liegen das zuviele andere Kunden mit einem Volumentarif am Mast eingebucht sind. LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); } { "context" : "envParam:entity", "actions" : [ ], "disableKudosForAnonUser" : "false", "context" : "lia-deleted-state", })(LITHIUM.jQuery); "parameters" : { "actions" : [ } "event" : "MessagesWidgetMessageEdit", { "linkDisabled" : "false" watching = true; } "action" : "rerender" ] "context" : "envParam:feedbackData", Öffentliche Lösungen helfen allen – schreibt uns daher bitte einen Beitrag statt einer unaufgeforderten PN. }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'k8Dusp3hBmS9mQV00gN4UwnfwR3tHDipYN-s_I5SN_I. "event" : "ProductAnswer", } }, "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "RevokeSolutionAction", "actions" : [ LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233622}); "context" : "", } "closeEvent" : "LITHIUM:lightboxCloseEvent", }, { "actions" : [ "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "removeThreadUserEmailSubscription", ] "componentId" : "forums.widget.message-view", var keycodes = { "kudosLinksDisabled" : "false", "action" : "rerender" } ] { }, "useTruncatedSubject" : "true", "actions" : [ }, "context" : "", }, "event" : "ProductMessageEdit", "componentId" : "kudos.widget.button", "eventActions" : [ })(LITHIUM.jQuery); // Pull in global jQuery reference LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73295","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Lu4n2GJ51uNS7KhBLJPVI4LOJHnC5BdNQILaOYDL-1Y. "entity" : "2218554", "actions" : [ ] ] { }, "context" : "", // Set start to true only if the first key in the sequence is pressed "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { } LITHIUM.AjaxSupport.ComponentEvents.set({ ] "action" : "rerender" "actions" : [ Da hab ich auch was gefunden, aber bei der einen steht was von Citybetrieb, bei der anderen Telekomnetz...Auch bei anderen Modellen habe ich nirgends gefunden, dass der gigacube erwähnt wurde. LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "displayStyle" : "horizontal", event.preventDefault(); { "actions" : [ } { ], watching = true; ] "actions" : [ "useSimpleView" : "false", }, "event" : "editProductMessage", LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_69b82a8d7795d9","tooltipContentSelector":"#link_69b82a8d7795d9_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_69b82a8d7795d9_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); { } "event" : "MessagesWidgetCommentForm", "dialogKey" : "dialogKey" }, Hallo, ich habe mir Vodafone Data Go LTE geholt, um damit unterwegs surfen zu können. { { "action" : "rerender" Mittlerweile bietet der Provider in den ersten Regionen sogar das superschnelle 5G. "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { }, ] { } ] Ersteller mavraph; Erstellt am 18 Dez 2019; Foren. }, "}); "action" : "rerender" "actions" : [ ] LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "event" : "MessagesWidgetAnswerForm", { }, "event" : "MessagesWidgetCommentForm", },

Icloud Sperre Entfernen 2020, Paris Arbeitsblatt Französisch, Einbürgerung München Dauer, Masterchef Final Kim Kazandı, Relief Therapeutics Dividende, Rb Leipzig Kader 2020/21, Lernerfolg Grundschule Erfahrungen, Unfall B71 Gestern,