} { "context" : "envParam:quiltName", ] "includeRepliesModerationState" : "false", "action" : "addClassName" "actions" : [ { "actions" : [ ] { // --> ] Ich sehe da kein Problem. "action" : "rerender" } } "actions" : [ "selector" : "#messageview_6", { "action" : "rerender" }, { ], "actions" : [ "context" : "", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); } } }); "actions" : [ "initiatorBinding" : true, } }); { { "event" : "RevokeSolutionAction", "context" : "envParam:selectedMessage", LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "message" : "1821801", }, LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.MessageAttachments({"selectors":{"attachmentIconContainer":".lia-attachment-icon-container","attachmentLinkSelector":".lia-message-attachment-link-row-element"},"misc":{"attachmentHighlighter":"lia-highlight-attachment","showAttachmentDetails":false}}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", { }, }, } } } } }, "dialogKey" : "dialogKey" // We're good so far. } "event" : "unapproveMessage", } ] { "event" : "kudoEntity", "useTruncatedSubject" : "true", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821584}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821845}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821622}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821662}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821666}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821748}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821801}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821845}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1822064}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1822090}}]); "event" : "removeMessageUserEmailSubscription", } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "removeThreadUserEmailSubscription", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "}); } "action" : "rerender" } "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" $(document).ready(function(){ "actions" : [ $(document).keydown(function(e) { "action" : "rerender" }, { LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1821662,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, { "action" : "rerender" }, }, "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" { "action" : "rerender" "event" : "removeMessageUserEmailSubscription", ] { "initiatorBinding" : true, "actions" : [ "context" : "", Telefonie geht! "action" : "rerender" "context" : "envParam:feedbackData", { "}); "initiatorBinding" : true, { }, } }, "actions" : [ } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "useTruncatedSubject" : "true", } "event" : "ProductMessageEdit", }, "actions" : [ "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } ', 'ajax'); "event" : "deleteMessage", "quiltName" : "ForumMessage", }, ] "useTruncatedSubject" : "true", }, { { var keycodes = { "context" : "lia-deleted-state", "initiatorDataMatcher" : "data-lia-kudos-id" "componentId" : "forums.widget.message-view", }, document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); ] "displayStyle" : "horizontal", { ] }, }, "truncateBodyRetainsHtml" : "false", }); ] }, ] "actions" : [ "actions" : [ { "quiltName" : "ForumMessage", "action" : "rerender" "componentId" : "kudos.widget.button", "event" : "ProductAnswer", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" } } ] } "action" : "rerender" "useCountToKudo" : "false", { { "action" : "rerender" "componentId" : "forums.widget.message-view", { setWarning(pagerId); }, "context" : "", }, "}); .attr('aria-expanded','false'); } }, "actions" : [ { //if(height > 430) { } }, } "event" : "editProductMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "addThreadUserEmailSubscription", { "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", }, { LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); { "actions" : [ ] "context" : "", "message" : "1821666", } "event" : "editProductMessage", "action" : "pulsate" "context" : "", ] { ] }; "event" : "editProductMessage", }, "context" : "", "context" : "", { { { }, ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "activecastFullscreen" : false, { { "event" : "ProductMessageEdit", $(document).ready(function(){ "action" : "rerender" LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1821845,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { { "actions" : [ ', 'ajax'); "event" : "addThreadUserEmailSubscription", { } "event" : "addMessageUserEmailSubscription", } "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ { }, }, "action" : "rerender" "action" : "addClassName" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "addThreadUserEmailSubscription", { "eventActions" : [ "action" : "rerender" ], "action" : "rerender" "actions" : [ { { ] }); "actions" : [ "action" : "rerender" "action" : "rerender" "actions" : [ "action" : "rerender" "actions" : [ ] "action" : "rerender" })(LITHIUM.jQuery); "event" : "kudoEntity", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "action" : "rerender" ', 'ajax'); "disableLinks" : "false", })(LITHIUM.jQuery); "action" : "rerender" }, }, { "event" : "markAsSpamWithoutRedirect", } }, "actions" : [ "action" : "rerender" "event" : "kudoEntity", o.innerHTML = ""; "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "displayStyle" : "horizontal", ] { ', 'ajax'); LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "context" : "envParam:quiltName,product,contextId,contextUrl", { } "quiltName" : "ForumMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", } "action" : "addClassName" Ich habe noch nicht viel Erfahrung im Bereich der mobilen Datennutzung. "context" : "envParam:quiltName", "action" : "rerender" "actions" : [ "truncateBody" : "true", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "", { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); }, { "truncateBody" : "true", "event" : "unapproveMessage", "action" : "rerender" { "event" : "ProductAnswer", "event" : "deleteMessage", "useTruncatedSubject" : "true", ] } "truncateBodyRetainsHtml" : "false", $(this).toggleClass("view-btn-open view-btn-close"); logmein: [76, 79, 71, 77, 69, 73, 78], { } "event" : "ProductAnswer", "actions" : [ ] }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); }, "actions" : [ "actions" : [ // --> ], "action" : "rerender" { { } ] // just for convenience, you need a login anyways... "disableLabelLinks" : "false", "context" : "envParam:feedbackData", Bist du sicher, dass du fortfahren möchtest? "event" : "kudoEntity", "disableLabelLinks" : "false", "context" : "", Es handelt sich dabei um ein Galaxy S5 mit Android 6.0.1. { LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" "disableLabelLinks" : "false", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "showCountOnly" : "false", "event" : "addThreadUserEmailSubscription", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "context" : "", "action" : "rerender" "context" : "envParam:selectedMessage", { ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); } }, { "componentId" : "forums.widget.message-view", o.innerHTML = "Page number can\'t exceed 2. "context" : "", "context" : "", "parameters" : { "action" : "addClassName" } ] ] "context" : "", } "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "action" : "rerender" { "event" : "editProductMessage", { "message" : "2116113", }, ] { ;(function($) { "event" : "removeThreadUserEmailSubscription", "action" : "rerender" } "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, { ] "action" : "rerender" "context" : "envParam:feedbackData", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73389","ajaxErrorEventName":"LITHIUM:ajaxError","token":"yLgLA7uWNLLvqyeTrVMonSugeAxMd13AIqXvFdyyxmw. } { { "dialogContentCssClass" : "lia-panel-dialog-content", }, { "context" : "", "action" : "rerender" "action" : "rerender" $('div[class*="-menu-btn"]').removeClass('active'); }); "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_69bbf8147b1a9f_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/ArchivStoerungsmeldungenMobilfunkLTE/thread-id/63936&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ] "action" : "rerender" "entity" : "1822090", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ }, ], "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ // Oops, not the right sequence, lets restart from the top. "eventActions" : [ LITHIUM.Dialog.options['1161598555'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "displaySubject" : "true", LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "actions" : [ "action" : "rerender" { "entity" : "1821666", "actions" : [ } }, "action" : "rerender" { if ( !watching ) { } count = 0; "actions" : [ } ', 'ajax'); "action" : "rerender" } { "action" : "rerender" //$('#lia-body').addClass('lia-window-scroll'); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "context" : "envParam:quiltName", { ] ] "event" : "unapproveMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { ], "context" : "envParam:quiltName,product,contextId,contextUrl", "useSimpleView" : "false", } "context" : "", "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2176300,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, ] ] "; ] "componentId" : "kudos.widget.button", { { }, "actions" : [ { }, "initiatorBinding" : true, "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "disableKudosForAnonUser" : "false", } "context" : "", "context" : "envParam:feedbackData", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); }, { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2176302,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten.

Schwarzer Rettich Hustensaft Thermomix, Asiatische Suppe Mit Kokosmilch, Heimat- Und Sachunterricht, Brokkoli Käse Kartoffel-auflauf, Finanzamt Celle Kinderfreibetrag ändern, Fahrplanwechsel Sbb 2021, Münster Veranstaltungen 2020,